(data stored in SCRATCH3701 zone)

EMBL: CP000435.CINA

CP000435.CINA        Location/Qualifiers
FT   CDS             311332..312603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cinA"
FT                   /locus_tag="sync_0302"
FT                   /product="CinA-like protein"
FT                   /note="identified by match to protein family HMM PF00994;
FT                   match to protein family HMM PF02464; match to protein
FT                   family HMM TIGR00199; match to protein family HMM
FT                   TIGR00200"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45609"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="InterPro:IPR041424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDD6"
FT                   /protein_id="ABI45609.1"
FT                   /translation="MADRSERSGVEILCVGTELLLGNILNGNARWLSEELATLGLPHFR
FT                   QTVVGDNRDRLIALVQEIAQRSRVLIVTGGLGPTPDDLTTEAIAAAFSVPLEERVDVWS
FT                   DIQEKARSRGRTPSPETRRQALLPVGAEVLWNPTGTAPGMIWTPVPGFSVLTFPGVPSE
FT                   MKAMWKATAVPWFRSSGLSKGVFVSRLLHFWGIGESTLAEQVADLLEGVNPTVAPYAGR
FT                   GEVKLRITACADVSSKAWVLVDQIEQELRQRTGNLCFGVDEDSLASVVLKRLGQTGQTL
FT                   SVAESCTGGGLGAELTAVPGASSVMLGGVISYSNAVKRDLLSVPEDLLTQHGAVSAQVA
FT                   EAMALGVRRLTGSDWALSITGIAGPDGGTPEKPVGLVFVGVAGPDGCSTEMLRLGPTRG
FT                   REWIRIVSAGEVLNRLRLRLMVND"
     MADRSERSGV EILCVGTELL LGNILNGNAR WLSEELATLG LPHFRQTVVG DNRDRLIALV        60
     QEIAQRSRVL IVTGGLGPTP DDLTTEAIAA AFSVPLEERV DVWSDIQEKA RSRGRTPSPE       120
     TRRQALLPVG AEVLWNPTGT APGMIWTPVP GFSVLTFPGV PSEMKAMWKA TAVPWFRSSG       180
     LSKGVFVSRL LHFWGIGEST LAEQVADLLE GVNPTVAPYA GRGEVKLRIT ACADVSSKAW       240
     VLVDQIEQEL RQRTGNLCFG VDEDSLASVV LKRLGQTGQT LSVAESCTGG GLGAELTAVP       300
     GASSVMLGGV ISYSNAVKRD LLSVPEDLLT QHGAVSAQVA EAMALGVRRL TGSDWALSIT       360
     GIAGPDGGTP EKPVGLVFVG VAGPDGCSTE MLRLGPTRGR EWIRIVSAGE VLNRLRLRLM       420
     VND                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page