(data stored in SCRATCH3701 zone)

EMBL: CP000435.CLPX

CP000435.CLPX        Location/Qualifiers
FT   CDS             complement(65892..67247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="sync_0064"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpX"
FT                   /note="identified by similarity to SP:P50866; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF06689; match to protein family HMM PF07724; match to
FT                   protein family HMM TIGR00382"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47536"
FT                   /db_xref="GOA:Q0IE20"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IE20"
FT                   /protein_id="ABI47536.1"
FT                   /translation="MAKFDAHLKCSFCGKSQEQVRKLIAGPGVYICDECIDLCNEILDE
FT                   ELIDAQGNPRHGAEPSKKTAAGGTRKTSKPAPTLATIPKPQEIKGFLDEQVVGQEAAKK
FT                   VMSVAVYNHYKRLAWQGDGQGEAAQTATRLHKSNILLIGPTGCGKTLLAQTLAEMLDVP
FT                   FAVADATTLTEAGYVGEDVENILLRLLQKADMDVEQAQRGIIYIDEIDKIARKSENPSI
FT                   TRDVSGEGVQQALLKMLEGTVANVPPQGGRKHPYQDCIQIDTSQILFICGGAFVGLDDV
FT                   VQKRMGRNAIGFVPNDGRGRNRATRDIQAAQVLRHLEPDDLVKYGLIPEFIGRMPVSAV
FT                   LEPLDEHALESILTEPRDALVKQFSTLLSMDNVQLDFEAQAVEAIAKEAHRRKTGARAL
FT                   RGIVEELMLDLMYELPSDQNVTAFTITKAMVEEHTGGKVLPLPGTKQHKESA"
     MAKFDAHLKC SFCGKSQEQV RKLIAGPGVY ICDECIDLCN EILDEELIDA QGNPRHGAEP        60
     SKKTAAGGTR KTSKPAPTLA TIPKPQEIKG FLDEQVVGQE AAKKVMSVAV YNHYKRLAWQ       120
     GDGQGEAAQT ATRLHKSNIL LIGPTGCGKT LLAQTLAEML DVPFAVADAT TLTEAGYVGE       180
     DVENILLRLL QKADMDVEQA QRGIIYIDEI DKIARKSENP SITRDVSGEG VQQALLKMLE       240
     GTVANVPPQG GRKHPYQDCI QIDTSQILFI CGGAFVGLDD VVQKRMGRNA IGFVPNDGRG       300
     RNRATRDIQA AQVLRHLEPD DLVKYGLIPE FIGRMPVSAV LEPLDEHALE SILTEPRDAL       360
     VKQFSTLLSM DNVQLDFEAQ AVEAIAKEAH RRKTGARALR GIVEELMLDL MYELPSDQNV       420
     TAFTITKAMV EEHTGGKVLP LPGTKQHKES A                                      451
//

If you have problems or comments...

PBIL Back to PBIL home page