(data stored in SCRATCH3701 zone)

EMBL: CP000435.CPCA

CP000435.CPCA        Location/Qualifiers
FT   CDS             complement(480605..481093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpcA"
FT                   /locus_tag="sync_0488"
FT                   /product="phycocyanin, alpha subunit"
FT                   /note="identified by match to protein family HMM PF00502;
FT                   match to protein family HMM TIGR01338"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45378"
FT                   /db_xref="GOA:Q0ICV7"
FT                   /db_xref="InterPro:IPR006246"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012128"
FT                   /db_xref="InterPro:IPR038719"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICV7"
FT                   /protein_id="ABI45378.1"
FT                   /translation="MKTPLTEAVAAADSQGRFLSNTEVQAASGRFNRAKASLDAAKGLT
FT                   AKADALVSSATQAVYTKFPYTTQMEGPNYSATSEGKAKCSRDIGYYLRMITYCLVAGGT
FT                   GPMDDYLIAGLDEINRTFELSPSWYVEALKHIQSNHGLSGDAATEANSYINYAINALT"
     MKTPLTEAVA AADSQGRFLS NTEVQAASGR FNRAKASLDA AKGLTAKADA LVSSATQAVY        60
     TKFPYTTQME GPNYSATSEG KAKCSRDIGY YLRMITYCLV AGGTGPMDDY LIAGLDEINR       120
     TFELSPSWYV EALKHIQSNH GLSGDAATEA NSYINYAINA LT                          162
//

If you have problems or comments...

PBIL Back to PBIL home page