(data stored in SCRATCH3701 zone)

EMBL: CP000435.CPCE

CP000435.CPCE        Location/Qualifiers
FT   CDS             complement(479125..479922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpcE"
FT                   /locus_tag="sync_0486"
FT                   /product="phycocyanin alpha subunit phycocyanobilin lyase,
FT                   CpcE subunit"
FT                   /EC_number="4.-.-.-"
FT                   /note="identified by match to protein family HMM PF03130"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47764"
FT                   /db_xref="GOA:Q0ICV9"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICV9"
FT                   /protein_id="ABI47764.1"
FT                   /translation="MKDPSPENLKPPLTEEQVIVNLRQTEDLSDQYYAAWWVGRMRSRH
FT                   PETLPLLLAALDPLHSNPINKERRAVALNAIRALGILQERSAEEDLRRLLKKNDYSIRE
FT                   ESARSLGMIQAKDAVPDLCKLLSGSTDEVEQIQSGSTKLKEPYESVLEALGAIGVASRS
FT                   VISMIKPFTKHSRPLIRASACRALLLLTDDQAWAPPLIELLQHDDPLIRRGVLLDLGAT
FT                   GWMPALPAIQAAAIENSLKLVALRGLAEKSEDISVLDAMDALL"
     MKDPSPENLK PPLTEEQVIV NLRQTEDLSD QYYAAWWVGR MRSRHPETLP LLLAALDPLH        60
     SNPINKERRA VALNAIRALG ILQERSAEED LRRLLKKNDY SIREESARSL GMIQAKDAVP       120
     DLCKLLSGST DEVEQIQSGS TKLKEPYESV LEALGAIGVA SRSVISMIKP FTKHSRPLIR       180
     ASACRALLLL TDDQAWAPPL IELLQHDDPL IRRGVLLDLG ATGWMPALPA IQAAAIENSL       240
     KLVALRGLAE KSEDISVLDA MDALL                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page