(data stored in SCRATCH3701 zone)

EMBL: CP000435.CRCB

CP000435.CRCB        Location/Qualifiers
FT   CDS             100098..100493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="sync_0095"
FT                   /product="crcB protein"
FT                   /note="identified by match to protein family HMM PF02537"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47095"
FT                   /db_xref="GOA:Q0IDZ0"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDZ0"
FT                   /protein_id="ABI47095.1"
FT                   /translation="MPQSSSSVTGQLSLRQDLNELALVALGAVPGAVMRWQIASHFHDK
FT                   DLIVNVLGAFILGWLVGLPLRPKRQLLIGIGFCGSLTTFSSWMVHCVTFIAQGDWLSAL
FT                   GLIGLTLGLGLGAAALGVLVGRSLVRR"
     MPQSSSSVTG QLSLRQDLNE LALVALGAVP GAVMRWQIAS HFHDKDLIVN VLGAFILGWL        60
     VGLPLRPKRQ LLIGIGFCGS LTTFSSWMVH CVTFIAQGDW LSALGLIGLT LGLGLGAAAL       120
     GVLVGRSLVR R                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page