(data stored in SCRATCH3701 zone)

EMBL: CP000435.CYSK-1

CP000435.CYSK-1      Location/Qualifiers
FT   CDS             complement(592297..593328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK-1"
FT                   /locus_tag="sync_0620"
FT                   /product="cysteine synthase A"
FT                   /EC_number="2.5.1.47"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM TIGR01136; match to protein
FT                   family HMM TIGR01139"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45685"
FT                   /db_xref="GOA:Q0ICI4"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICI4"
FT                   /protein_id="ABI45685.1"
FT                   /translation="MPMLAIKFLENNSSLMSRVYADNSQAIGNTPLVRLNHVTKGCKAT
FT                   VLAKIEGRNPAYSVKCRIGANMIWDAEKRGVLSEGKTIVEPTSGNTGIALAFTAAARGY
FT                   KLILTMPESMSIERRRVMAVLGAELILTEAAKGMPGAIAKAKEIADSDPSKYFMPGQFD
FT                   NPANPEIHEKTTGPEIWDDCDGAIDVLVAGVGTGGTITGVSRYIKQEKGKAITSVAVEP
FT                   SHSPVITQTMNGEALKPGPHKIQGIGAGFIPNNLDLSVVDRVEQVTNEESIEMALRLAQ
FT                   EEGLLVGISCGAATAAAIRLAQQDEFAGKTIVVVLPDLAERYLSSVMFADVPTGIIEQP
FT                   VPV"
     MPMLAIKFLE NNSSLMSRVY ADNSQAIGNT PLVRLNHVTK GCKATVLAKI EGRNPAYSVK        60
     CRIGANMIWD AEKRGVLSEG KTIVEPTSGN TGIALAFTAA ARGYKLILTM PESMSIERRR       120
     VMAVLGAELI LTEAAKGMPG AIAKAKEIAD SDPSKYFMPG QFDNPANPEI HEKTTGPEIW       180
     DDCDGAIDVL VAGVGTGGTI TGVSRYIKQE KGKAITSVAV EPSHSPVITQ TMNGEALKPG       240
     PHKIQGIGAG FIPNNLDLSV VDRVEQVTNE ESIEMALRLA QEEGLLVGIS CGAATAAAIR       300
     LAQQDEFAGK TIVVVLPDLA ERYLSSVMFA DVPTGIIEQP VPV                         343
//

If you have problems or comments...

PBIL Back to PBIL home page