(data stored in SCRATCH3701 zone)

EMBL: CP000435.DEOC

CP000435.DEOC        Location/Qualifiers
FT   CDS             complement(574088..574768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoC"
FT                   /locus_tag="sync_0605"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="identified by match to protein family HMM TIGR00126"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46012"
FT                   /db_xref="GOA:Q0ICJ9"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICJ9"
FT                   /protein_id="ABI46012.1"
FT                   /translation="MTASPRQRELPELPPFIHQAVLDPLLEEEALHNLCDAGRLLGFGG
FT                   LCTSLCHLEAVRNRIGPSGRLRLFAVVDFPFGTIPAELKRAQAEWAAARGADALDVVPN
FT                   LAAITAGRAETYAEELAQICDLGLPVTVILDVNRLQPEQLSLAVEAAIDAGASCLQAGN
FT                   GFGAATTPLQVRKLKELARGNCAIKAAGGIQRLDSALDLMEEGATALGTSHGPALIQAL
FT                   RHPQ"
     MTASPRQREL PELPPFIHQA VLDPLLEEEA LHNLCDAGRL LGFGGLCTSL CHLEAVRNRI        60
     GPSGRLRLFA VVDFPFGTIP AELKRAQAEW AAARGADALD VVPNLAAITA GRAETYAEEL       120
     AQICDLGLPV TVILDVNRLQ PEQLSLAVEA AIDAGASCLQ AGNGFGAATT PLQVRKLKEL       180
     ARGNCAIKAA GGIQRLDSAL DLMEEGATAL GTSHGPALIQ ALRHPQ                      226
//

If you have problems or comments...

PBIL Back to PBIL home page