(data stored in SCRATCH3701 zone)

EMBL: CP000435.EDA

CP000435.EDA         Location/Qualifiers
FT   CDS             360670..361320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eda"
FT                   /locus_tag="sync_0356"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /EC_number="4.1.3.16"
FT                   /note="identified by similarity to SP:P50846; match to
FT                   protein family HMM PF01081"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45750"
FT                   /db_xref="GOA:Q0ID84"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID84"
FT                   /protein_id="ABI45750.1"
FT                   /translation="MYELLSTSDRQQWLMASLRRQPLIVVLRPKESDLLGPFLQSLLCQ
FT                   RLDQLVDLGVHHIEIAWMDHSHWSDLITAIRLRHPALQLGVASVTSERGLQAVIDLDLP
FT                   YAMSPLLDQGLVLMAHQHNCCFVPGVMTPTEIRQAFVLGCHVVKLFPAVVLGLDYHRQI
FT                   SAPMGDLPFMIAAGGLTVADLDPWLSAGYDAIALGRGVLSTTDAIADLRDWLT"
     MYELLSTSDR QQWLMASLRR QPLIVVLRPK ESDLLGPFLQ SLLCQRLDQL VDLGVHHIEI        60
     AWMDHSHWSD LITAIRLRHP ALQLGVASVT SERGLQAVID LDLPYAMSPL LDQGLVLMAH       120
     QHNCCFVPGV MTPTEIRQAF VLGCHVVKLF PAVVLGLDYH RQISAPMGDL PFMIAAGGLT       180
     VADLDPWLSA GYDAIALGRG VLSTTDAIAD LRDWLT                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page