(data stored in SCRATCH3701 zone)

EMBL: CP000435.EFP

CP000435.EFP         Location/Qualifiers
FT   CDS             37588..38151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="sync_0032"
FT                   /product="translation elongation factor P"
FT                   /note="identified by match to protein family HMM PF01132;
FT                   match to protein family HMM PF08207; match to protein
FT                   family HMM TIGR00038"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47842"
FT                   /db_xref="GOA:Q0IE51"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IE51"
FT                   /protein_id="ABI47842.1"
FT                   /translation="MISSNDFRTGTTIELDGAVWRVVEFLHVKPGKGSAFVRTKLKAVQ
FT                   SGSVVEKTFRAGEMLQQALLEKSTLQHTYMEGEDFVFMDMSTYEETRLTAKQIGDSRKY
FT                   LKEGMEVNVVTWNEKPLEVELPNSVVLEIAQTDPGVKGDTATGGTKPAILETGAQVMVP
FT                   LFLSIGEKIKVDTRNDTYLGRENG"
     MISSNDFRTG TTIELDGAVW RVVEFLHVKP GKGSAFVRTK LKAVQSGSVV EKTFRAGEML        60
     QQALLEKSTL QHTYMEGEDF VFMDMSTYEE TRLTAKQIGD SRKYLKEGME VNVVTWNEKP       120
     LEVELPNSVV LEIAQTDPGV KGDTATGGTK PAILETGAQV MVPLFLSIGE KIKVDTRNDT       180
     YLGRENG                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page