(data stored in SCRATCH3701 zone)

EMBL: CP000435.ENGA

CP000435.ENGA        Location/Qualifiers
FT   CDS             565834..567201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engA"
FT                   /locus_tag="sync_0596"
FT                   /product="GTP-binding protein EngA"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00650"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46603"
FT                   /db_xref="GOA:Q0ICK8"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICK8"
FT                   /protein_id="ABI46603.1"
FT                   /translation="MARPVVAIIGRPNVGKSTLVNRLCRSREAIVHDQPGVTRDRTYQD
FT                   GYWGDREFKVVDTGGLVFDDDSEFLPEIREQASLALAEASVALVIVDGQQGLTAADESI
FT                   AEWLRTQNCKTLLAVNKCESPEQGLGMAAEFWRLGLGEPHPISAIHGAGTAELLDQVLT
FT                   FLPPKDEESDEEEPIQLSIIGRPNVGKSSLLNSICGETRAIVSPIRGTTRDTIDTRIER
FT                   ENRRWRLIDTAGIRRRRSVNYGPEFFGINRSFKAIERSDVCVLVIDALDGVTEQDQRLA
FT                   GRIEEDGRACVVVVNKWDAVEKDSHTMTAMEKELRAKLYFLDWAPMLFTSALTGQRVDS
FT                   IFALAALAVEQHRRRVSTSVVNEVLKEALSWRSPPTTRGGRQGRLYYGTQVASRPPSFT
FT                   LFVNEPKLFGDTYRRYVERQIREGLGFDGTPVKLFWRGKQQRDAEKELVRQQNRQG"
     MARPVVAIIG RPNVGKSTLV NRLCRSREAI VHDQPGVTRD RTYQDGYWGD REFKVVDTGG        60
     LVFDDDSEFL PEIREQASLA LAEASVALVI VDGQQGLTAA DESIAEWLRT QNCKTLLAVN       120
     KCESPEQGLG MAAEFWRLGL GEPHPISAIH GAGTAELLDQ VLTFLPPKDE ESDEEEPIQL       180
     SIIGRPNVGK SSLLNSICGE TRAIVSPIRG TTRDTIDTRI ERENRRWRLI DTAGIRRRRS       240
     VNYGPEFFGI NRSFKAIERS DVCVLVIDAL DGVTEQDQRL AGRIEEDGRA CVVVVNKWDA       300
     VEKDSHTMTA MEKELRAKLY FLDWAPMLFT SALTGQRVDS IFALAALAVE QHRRRVSTSV       360
     VNEVLKEALS WRSPPTTRGG RQGRLYYGTQ VASRPPSFTL FVNEPKLFGD TYRRYVERQI       420
     REGLGFDGTP VKLFWRGKQQ RDAEKELVRQ QNRQG                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page