(data stored in SCRATCH3701 zone)

EMBL: CP000435.FABF

CP000435.FABF        Location/Qualifiers
FT   CDS             complement(138921..140168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="sync_0131"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /note="identified by match to protein family HMM PF00109;
FT                   match to protein family HMM PF02801"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45982"
FT                   /db_xref="GOA:Q0IDV4"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDV4"
FT                   /protein_id="ABI45982.1"
FT                   /translation="MVEGLQRVVVTGLGAVTPIGNTVADYWEGLTSAKNGVEAITLFDA
FT                   AQHACRFAAEVKNFDPSGFIEPKDAKRWDRFCKFGVVAAKQALTDSGLTITPDNADRIG
FT                   VSIGSGVGGLLTMETQAHVLKDKAPGRVSPFTVPMMIPNMATGLAAIALGAKGPSSAVA
FT                   TACAAGSNAIGDAFQLLQLGKADAMICGGAESAITPLGVAGFASAKALSFRNDDPAGAS
FT                   RPFDKTRDGFVIGEGSGILVLETLAHAEARGATILAEIVGYGTTCDAHHITSPTPGGVG
FT                   GAAAIRLALEDGGIAADSVDYVNAHGTSTPANDSNETAAIKSALGSRAKDIPVSSTKSM
FT                   TGHLLGGSGGIEAVACVLALRNGVVPPTINYNNPDPECDLDVVPNTARELTLGTVLSNS
FT                   FGFGGHNVCLAFRRMS"
     MVEGLQRVVV TGLGAVTPIG NTVADYWEGL TSAKNGVEAI TLFDAAQHAC RFAAEVKNFD        60
     PSGFIEPKDA KRWDRFCKFG VVAAKQALTD SGLTITPDNA DRIGVSIGSG VGGLLTMETQ       120
     AHVLKDKAPG RVSPFTVPMM IPNMATGLAA IALGAKGPSS AVATACAAGS NAIGDAFQLL       180
     QLGKADAMIC GGAESAITPL GVAGFASAKA LSFRNDDPAG ASRPFDKTRD GFVIGEGSGI       240
     LVLETLAHAE ARGATILAEI VGYGTTCDAH HITSPTPGGV GGAAAIRLAL EDGGIAADSV       300
     DYVNAHGTST PANDSNETAA IKSALGSRAK DIPVSSTKSM TGHLLGGSGG IEAVACVLAL       360
     RNGVVPPTIN YNNPDPECDL DVVPNTAREL TLGTVLSNSF GFGGHNVCLA FRRMS            415
//

If you have problems or comments...

PBIL Back to PBIL home page