(data stored in SCRATCH3701 zone)

EMBL: CP000435.GLMS

CP000435.GLMS        Location/Qualifiers
FT   CDS             140865..142751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="sync_0134"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /EC_number="2.6.1.16"
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF01380; match to protein
FT                   family HMM TIGR01135"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45563"
FT                   /db_xref="GOA:Q0IDV1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDV1"
FT                   /protein_id="ABI45563.1"
FT                   /translation="MCGIVAVIGSRDAAPLLLEGLRQLEYRGYDSAGISTLQGKDLHCL
FT                   RAKGKLNNLTVRVDSEGAPGLCGIGHTRWATHGKPEEHNAHPHRDGSGRVAVVQNGIIE
FT                   NHRALREELTAAGVSFQSETDTEVIPHLIAAQLQLMGVSEGAGNGQILLEAVQAVLPRL
FT                   QGAYALAVLWADAPGALVVARKAAPLLIGLGEGEFLCASDTPALAGFTRTILPMEDGEV
FT                   ALLSPLGIELYDAEGARQQRTPTILSGSDHIADKRHFRHFMLKEIHEQPETARLWVDRH
FT                   LPVGLTAANPVALPFEESFYEGVDRIQILACGTSRHAALVGAYLLEQFAGLPTTVFYAS
FT                   EFRYAPPPLAPNTLTIGVTQSGETADTLAALSMDAKRRQAYGQPGYAPKQLGVTNRTES
FT                   SLARQVPHILDIGAGIEVGVAATKTFLGQLLAFYGLAVAFAARRGHRSETEISELLEEL
FT                   RALPEQLERLVDHHDKGSEALAPRFAETQDVIFLGRGINYPIALEGALKLKEISYIHAE
FT                   GYPAGEMKHGPIALLDSHVPVVSIAMPGPVFEKVLSNAQEAKARDAQMIGVAPVGPDTE
FT                   LFDALLPVPEVSEWVSPLLTVVPMQLLSYHIAAYRGLDVDQPRNLAKSVTVE"
     MCGIVAVIGS RDAAPLLLEG LRQLEYRGYD SAGISTLQGK DLHCLRAKGK LNNLTVRVDS        60
     EGAPGLCGIG HTRWATHGKP EEHNAHPHRD GSGRVAVVQN GIIENHRALR EELTAAGVSF       120
     QSETDTEVIP HLIAAQLQLM GVSEGAGNGQ ILLEAVQAVL PRLQGAYALA VLWADAPGAL       180
     VVARKAAPLL IGLGEGEFLC ASDTPALAGF TRTILPMEDG EVALLSPLGI ELYDAEGARQ       240
     QRTPTILSGS DHIADKRHFR HFMLKEIHEQ PETARLWVDR HLPVGLTAAN PVALPFEESF       300
     YEGVDRIQIL ACGTSRHAAL VGAYLLEQFA GLPTTVFYAS EFRYAPPPLA PNTLTIGVTQ       360
     SGETADTLAA LSMDAKRRQA YGQPGYAPKQ LGVTNRTESS LARQVPHILD IGAGIEVGVA       420
     ATKTFLGQLL AFYGLAVAFA ARRGHRSETE ISELLEELRA LPEQLERLVD HHDKGSEALA       480
     PRFAETQDVI FLGRGINYPI ALEGALKLKE ISYIHAEGYP AGEMKHGPIA LLDSHVPVVS       540
     IAMPGPVFEK VLSNAQEAKA RDAQMIGVAP VGPDTELFDA LLPVPEVSEW VSPLLTVVPM       600
     QLLSYHIAAY RGLDVDQPRN LAKSVTVE                                          628
//

If you have problems or comments...

PBIL Back to PBIL home page