(data stored in SCRATCH3701 zone)

EMBL: CP000435.GLPA

CP000435.GLPA        Location/Qualifiers
FT   CDS             complement(545204..546778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpA"
FT                   /locus_tag="sync_0568"
FT                   /product="glycerol dehydrogenase homolog"
FT                   /EC_number="1.1.5.3"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45212"
FT                   /db_xref="GOA:Q0ICN4"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICN4"
FT                   /protein_id="ABI45212.1"
FT                   /translation="MADQRFDLVVIGGGASGCSVAYEAVRRGLRVALLEGHDLGSGTSC
FT                   RSTKLLHGGVRYLELAFKTADLAQLHLVREALLERGHWLNQAPFLAQRLELALPSDCRL
FT                   GQAYYRIGLGLYDALSGRAGIGSSRLLSSKQLQQALPLLRPDVRRGVAYSDGQFDDARL
FT                   NLLLALTAERAGAVLRTRTKVRELERNSQGQICAAISENHKGEQERWEARAVVNATGIH
FT                   ADAIRRMAAPNCSMRMLTSRGVHLVLRANLCPDGLGLLLPSTDDGRVLFMLPFFGRTLV
FT                   GTTDTPCTQASAAAPSEDEQNYLLDYVRRWFPDLSQPDVGSCWAGGRPLLKPAGAEVNS
FT                   SRVVREHEVERLNCGLISVMGGKWTTCRPMAIDTLKAVEAQFGSPLPDPASLPLIGADQ
FT                   DPKRTPTLLQEQVCALERLLPETPLRDQQRAHLQATFGLEAAALVASWNESDREPLSDV
FT                   IPVCRGEFRHAIRAEHACTATDVLARRCRLAMVDQDEAERLLPQVQALLEEAGVDAPYT
FT                   PELNLSC"
     MADQRFDLVV IGGGASGCSV AYEAVRRGLR VALLEGHDLG SGTSCRSTKL LHGGVRYLEL        60
     AFKTADLAQL HLVREALLER GHWLNQAPFL AQRLELALPS DCRLGQAYYR IGLGLYDALS       120
     GRAGIGSSRL LSSKQLQQAL PLLRPDVRRG VAYSDGQFDD ARLNLLLALT AERAGAVLRT       180
     RTKVRELERN SQGQICAAIS ENHKGEQERW EARAVVNATG IHADAIRRMA APNCSMRMLT       240
     SRGVHLVLRA NLCPDGLGLL LPSTDDGRVL FMLPFFGRTL VGTTDTPCTQ ASAAAPSEDE       300
     QNYLLDYVRR WFPDLSQPDV GSCWAGGRPL LKPAGAEVNS SRVVREHEVE RLNCGLISVM       360
     GGKWTTCRPM AIDTLKAVEA QFGSPLPDPA SLPLIGADQD PKRTPTLLQE QVCALERLLP       420
     ETPLRDQQRA HLQATFGLEA AALVASWNES DREPLSDVIP VCRGEFRHAI RAEHACTATD       480
     VLARRCRLAM VDQDEAERLL PQVQALLEEA GVDAPYTPEL NLSC                        524
//

If you have problems or comments...

PBIL Back to PBIL home page