(data stored in SCRATCH3701 zone)

EMBL: CP000435.GLYA

CP000435.GLYA        Location/Qualifiers
FT   CDS             308836..310125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="sync_0300"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="identified by similarity to SP:P39148; match to
FT                   protein family HMM PF00155; match to protein family HMM
FT                   PF00464; match to protein family HMM PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46562"
FT                   /db_xref="GOA:Q0IDD8"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDD8"
FT                   /protein_id="ABI46562.1"
FT                   /translation="MTDRSAAPINASLKAADPAIAGLIDQEQMRQETHLELIASENFTS
FT                   KAVMEAQGSVLTNKYAEGLPHKRYYGGCEHVDAIEELAITRAKQLFGAAWANVQPHSGA
FT                   QANFAVFLALLQPGDTILGMDLSHGGHLTHGSPVNVSGKWFNVVQYGVDKETQRLDMEA
FT                   IRKLALEHKPKLIICGYSAYPRSIDFAAFRSIADEVGAYLLADMAHIAGLVAAGVHASP
FT                   VPHCDVVTTTTHKTLRGPRGGLILCRDAEFARRFDKAVFPGSQGGPLEHVIAAKAVAFG
FT                   EALQPDFKAYSRQVVANAQALAARLQERKIDVVSGGTDNHVVLLDLRSIGMTGKVADLL
FT                   VSDVHITANKNTVPFDPESPFVTSGLRLGTAALTTRGFDEKAFHEVADVIADRLQNPED
FT                   DAIQARCLERVSDLCKRFPLYAPALEPALA"
     MTDRSAAPIN ASLKAADPAI AGLIDQEQMR QETHLELIAS ENFTSKAVME AQGSVLTNKY        60
     AEGLPHKRYY GGCEHVDAIE ELAITRAKQL FGAAWANVQP HSGAQANFAV FLALLQPGDT       120
     ILGMDLSHGG HLTHGSPVNV SGKWFNVVQY GVDKETQRLD MEAIRKLALE HKPKLIICGY       180
     SAYPRSIDFA AFRSIADEVG AYLLADMAHI AGLVAAGVHA SPVPHCDVVT TTTHKTLRGP       240
     RGGLILCRDA EFARRFDKAV FPGSQGGPLE HVIAAKAVAF GEALQPDFKA YSRQVVANAQ       300
     ALAARLQERK IDVVSGGTDN HVVLLDLRSI GMTGKVADLL VSDVHITANK NTVPFDPESP       360
     FVTSGLRLGT AALTTRGFDE KAFHEVADVI ADRLQNPEDD AIQARCLERV SDLCKRFPLY       420
     APALEPALA                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page