(data stored in SCRATCH3701 zone)

EMBL: CP000435.GPH

CP000435.GPH         Location/Qualifiers
FT   CDS             complement(512266..513057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gph"
FT                   /locus_tag="sync_0530"
FT                   /product="Haloacid dehalogenase/epoxide hydrolase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46880"
FT                   /db_xref="GOA:Q0ICR6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICR6"
FT                   /protein_id="ABI46880.1"
FT                   /translation="MAHLSLRGHSLGLIHGVLFDKDGTLSHSEPHLIELADARIEEIIR
FT                   VFASRGASTDVQSQLEGLLKRAMGRCDSGLIPDGPLAVASRQHNLLSTATLFCLFDLSW
FT                   PQALVLAEEIFDSVDRLHKHNATKESLSARNPLPHSRELLNELHSAGVICAVISNDTQH
FT                   GIEQFLQDHGLSDFITGIWSADDTPCKPDPGAVHGLCRQLHLDPSQCALIGDADSDLLM
FT                   ARRAGIGYALGYVAGWHRPPDLTSHQYLIHHWQELRVEQAL"
     MAHLSLRGHS LGLIHGVLFD KDGTLSHSEP HLIELADARI EEIIRVFASR GASTDVQSQL        60
     EGLLKRAMGR CDSGLIPDGP LAVASRQHNL LSTATLFCLF DLSWPQALVL AEEIFDSVDR       120
     LHKHNATKES LSARNPLPHS RELLNELHSA GVICAVISND TQHGIEQFLQ DHGLSDFITG       180
     IWSADDTPCK PDPGAVHGLC RQLHLDPSQC ALIGDADSDL LMARRAGIGY ALGYVAGWHR       240
     PPDLTSHQYL IHHWQELRVE QAL                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page