(data stored in SCRATCH3701 zone)

EMBL: CP000435.GYRA-1

CP000435.GYRA-1      Location/Qualifiers
FT   CDS             complement(6024..8486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA-1"
FT                   /locus_tag="sync_0005"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00521;
FT                   match to protein family HMM PF03989"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46187"
FT                   /db_xref="GOA:Q0IE78"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE78"
FT                   /protein_id="ABI46187.1"
FT                   /translation="MAEERVQSIALHHEMQRSYLEYAMSVIVGRALPDVRDGLKPVQRR
FT                   ILFAMHELGLTPDRPYRKCARVVGDVLGKYHPHGDQAVYDALVRLVQTFSSRHPLLDGH
FT                   GNFGSVDDDPPAAMRYTETRLARISHEGLLDEIGDDTVDFASNFDGSQQEPTVLPAQLP
FT                   FLLLNGCSGIAVGMATSIPPHNLGEVVDGLIALVQNPDLSENEVLKLIPGPDFPTGGEV
FT                   LLGSGVRETYLRGRGSIPMRGVAHIEEVHPGKGKHRRNAVIVTELPYQLSKAGWIEKLA
FT                   EHVNDGKIGGIADIRDESDREGMRVVVELRRDADPETVLTDLQRRTSLQSNFGAILLAL
FT                   VDGRPQQLTLRQLLQTFLDYRELTIIRRTNHALRKTEDRLEVVEGLTTALASLQQVIAM
FT                   IQEARDAAKARASLMVHFDLSERQADAVLAMPLRRLTGLEQESLRKEADDLRKERQRLT
FT                   LLLENRDQLLDALIQELRQLKKRFATPRRTRLVEGGDHLLAERAASQRPNAELQRRQAL
FT                   DALPSDSRLLIQDDGQVKIVSPQLLGRLHLNDPIPMGDEPSPALISLPIQPPPRLLAVT
FT                   VSGRVALVRWEFAGQQQGTLERFLPTALEGDEVVSLLPLPNPEDLVANETKSLGLLTSD
FT                   GRFKRLPLKDIQELSGRAATVLKLKEGVSLKAALICQDGADVAVISDIGRVLRLQAEET
FT                   NLPVMGKLAQGPITMRLLPGEQLVTAIAGHAERPTTILLASQTGRLQWLELTCIRSCKR
FT                   GDLGEIGWEFDSESTSGSERIAAACLADSLIGVVTSSGRHGRLKVNEQDQLTLKDNESI
FT                   LRLVPLIS"
     MAEERVQSIA LHHEMQRSYL EYAMSVIVGR ALPDVRDGLK PVQRRILFAM HELGLTPDRP        60
     YRKCARVVGD VLGKYHPHGD QAVYDALVRL VQTFSSRHPL LDGHGNFGSV DDDPPAAMRY       120
     TETRLARISH EGLLDEIGDD TVDFASNFDG SQQEPTVLPA QLPFLLLNGC SGIAVGMATS       180
     IPPHNLGEVV DGLIALVQNP DLSENEVLKL IPGPDFPTGG EVLLGSGVRE TYLRGRGSIP       240
     MRGVAHIEEV HPGKGKHRRN AVIVTELPYQ LSKAGWIEKL AEHVNDGKIG GIADIRDESD       300
     REGMRVVVEL RRDADPETVL TDLQRRTSLQ SNFGAILLAL VDGRPQQLTL RQLLQTFLDY       360
     RELTIIRRTN HALRKTEDRL EVVEGLTTAL ASLQQVIAMI QEARDAAKAR ASLMVHFDLS       420
     ERQADAVLAM PLRRLTGLEQ ESLRKEADDL RKERQRLTLL LENRDQLLDA LIQELRQLKK       480
     RFATPRRTRL VEGGDHLLAE RAASQRPNAE LQRRQALDAL PSDSRLLIQD DGQVKIVSPQ       540
     LLGRLHLNDP IPMGDEPSPA LISLPIQPPP RLLAVTVSGR VALVRWEFAG QQQGTLERFL       600
     PTALEGDEVV SLLPLPNPED LVANETKSLG LLTSDGRFKR LPLKDIQELS GRAATVLKLK       660
     EGVSLKAALI CQDGADVAVI SDIGRVLRLQ AEETNLPVMG KLAQGPITMR LLPGEQLVTA       720
     IAGHAERPTT ILLASQTGRL QWLELTCIRS CKRGDLGEIG WEFDSESTSG SERIAAACLA       780
     DSLIGVVTSS GRHGRLKVNE QDQLTLKDNE SILRLVPLIS                             820
//

If you have problems or comments...

PBIL Back to PBIL home page