(data stored in SCRATCH3701 zone)

EMBL: CP000435.HISB

CP000435.HISB        Location/Qualifiers
FT   CDS             266613..267218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="sync_0260"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="identified by match to protein family HMM PF00475"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46270"
FT                   /db_xref="GOA:Q0IDH6"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDH6"
FT                   /protein_id="ABI46270.1"
FT                   /translation="MRTGEIHRVTGETDVSVRLGLDGSGRCQASTGVPFLDHMLHQISS
FT                   HGLIDLEITASGDTHIDDHHTNEDVGIAFGQALSKALGDRRGIYRFGHFVAPLDEALVQ
FT                   VVLDCSGRPHISWGLTIPTQKIGTYDTELVKEFFVAVVNNSGLTLHIRQLDGVNSHHIV
FT                   EACFKAFSRALRMATEIDPRRSGLVPSSKGVLEQAGGS"
     MRTGEIHRVT GETDVSVRLG LDGSGRCQAS TGVPFLDHML HQISSHGLID LEITASGDTH        60
     IDDHHTNEDV GIAFGQALSK ALGDRRGIYR FGHFVAPLDE ALVQVVLDCS GRPHISWGLT       120
     IPTQKIGTYD TELVKEFFVA VVNNSGLTLH IRQLDGVNSH HIVEACFKAF SRALRMATEI       180
     DPRRSGLVPS SKGVLEQAGG S                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page