(data stored in SCRATCH3701 zone)

EMBL: CP000435.HOLA

CP000435.HOLA        Location/Qualifiers
FT   CDS             complement(81808..82788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="sync_0077"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF06144;
FT                   match to protein family HMM TIGR01128"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45993"
FT                   /db_xref="GOA:Q0IE07"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE07"
FT                   /protein_id="ABI45993.1"
FT                   /translation="MPIHLLWGDDSAARDRAVAALIEEAIDPTWSSINLSRLDGSEAGQ
FT                   AQQALEEARTPPFGAGMRVVLLQRSPFCNACPSELADRFEAALELIPDSTQLVLTNPAK
FT                   PDGRLRTTKALQKRVKQGLASEQKFQLPAIWDGAGQRQLVERTAAGLNVDMEAEAVSAL
FT                   VDAIGNDSARLTMELQKLALHAESHGHKRISAEAVQTLIEGQATSALAVGDALLEGDAG
FT                   GAIGLLDALIDAGEPALRIVATLTGQIRGWLWVLLLEQQGERDVAVIAKAAGIGNPKRI
FT                   YVMRKQLQGGNPKRLLSLLGRLLKVEAMLKRGALAGDAFREGLLG"
     MPIHLLWGDD SAARDRAVAA LIEEAIDPTW SSINLSRLDG SEAGQAQQAL EEARTPPFGA        60
     GMRVVLLQRS PFCNACPSEL ADRFEAALEL IPDSTQLVLT NPAKPDGRLR TTKALQKRVK       120
     QGLASEQKFQ LPAIWDGAGQ RQLVERTAAG LNVDMEAEAV SALVDAIGND SARLTMELQK       180
     LALHAESHGH KRISAEAVQT LIEGQATSAL AVGDALLEGD AGGAIGLLDA LIDAGEPALR       240
     IVATLTGQIR GWLWVLLLEQ QGERDVAVIA KAAGIGNPKR IYVMRKQLQG GNPKRLLSLL       300
     GRLLKVEAML KRGALAGDAF REGLLG                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page