(data stored in SCRATCH3701 zone)

EMBL: CP000435.INFC

CP000435.INFC        Location/Qualifiers
FT   CDS             complement(95647..96285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="sync_0090"
FT                   /product="translation initiation factor IF-3"
FT                   /note="identified by similarity to SP:O33567; match to
FT                   protein family HMM PF00707; match to protein family HMM
FT                   PF05198; match to protein family HMM TIGR00168"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45868"
FT                   /db_xref="GOA:Q0IDZ5"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDZ5"
FT                   /protein_id="ABI45868.1"
FT                   /translation="MPPRPRFDRRAPVRELPNINDRINYPQLRVVDADGEQLGVIDREQ
FT                   ALEVARERELDLVLVSEKADPPVCRIMDYGKFKFEQEKKAKEAKKKSHQTEVKEVKMRY
FT                   KIDQHDYDVRIGQAQRFLKAGDKVKCTVIFRGREIQHTALAEVLLRRMAKDLEEPAEVQ
FT                   QPPKREGRNMIMFLTPRKAPLVKKDKDEEVVNKAVRTIPSPARRINTQD"
     MPPRPRFDRR APVRELPNIN DRINYPQLRV VDADGEQLGV IDREQALEVA RERELDLVLV        60
     SEKADPPVCR IMDYGKFKFE QEKKAKEAKK KSHQTEVKEV KMRYKIDQHD YDVRIGQAQR       120
     FLKAGDKVKC TVIFRGREIQ HTALAEVLLR RMAKDLEEPA EVQQPPKREG RNMIMFLTPR       180
     KAPLVKKDKD EEVVNKAVRT IPSPARRINT QD                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page