(data stored in SCRATCH3701 zone)

EMBL: CP000435.ISPH

CP000435.ISPH        Location/Qualifiers
FT   CDS             complement(302352..303548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /locus_tag="sync_0292"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /EC_number="1.17.1.2"
FT                   /note="identified by match to protein family HMM PF02401;
FT                   match to protein family HMM TIGR00216"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45510"
FT                   /db_xref="GOA:Q0IDE5"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDE5"
FT                   /protein_id="ABI45510.1"
FT                   /translation="MDTHAFKRSLHHSDRYNRRGFGRADEVAGSLEQAYQSSLIGSIRD
FT                   NGYSLTHGRLKVRLAEAFGFCWGVERAVAMAYETRRHYPQERIWITNEIIHNPSVNDHL
FT                   REMDVLFISVEGGVKDFSGVATGDVVILPAFGATVQEMQLLNERGCHIVDTTCPWVSKV
FT                   WTTVEKHKKQSFTSIIHGKVKHEETLATSSFAGTYLVVLDLEEARLVADYILGKGNRES
FT                   FMERFSKACSPGFDPDRDLEHLGVANQTTMLKSETEEIGRLFERTMLSKYGPTDLNEHF
FT                   LAFNTICDATQERQDAMFSLVDETVDLMVVIGGYNSSNTTHLQEIAVSRGIRSFHIDTP
FT                   ERIHTDNSIEHKPLGEELTVEELFLPSGPVTVGITSGASTPDRVVEHVIQRLIALSEN"
     MDTHAFKRSL HHSDRYNRRG FGRADEVAGS LEQAYQSSLI GSIRDNGYSL THGRLKVRLA        60
     EAFGFCWGVE RAVAMAYETR RHYPQERIWI TNEIIHNPSV NDHLREMDVL FISVEGGVKD       120
     FSGVATGDVV ILPAFGATVQ EMQLLNERGC HIVDTTCPWV SKVWTTVEKH KKQSFTSIIH       180
     GKVKHEETLA TSSFAGTYLV VLDLEEARLV ADYILGKGNR ESFMERFSKA CSPGFDPDRD       240
     LEHLGVANQT TMLKSETEEI GRLFERTMLS KYGPTDLNEH FLAFNTICDA TQERQDAMFS       300
     LVDETVDLMV VIGGYNSSNT THLQEIAVSR GIRSFHIDTP ERIHTDNSIE HKPLGEELTV       360
     EELFLPSGPV TVGITSGAST PDRVVEHVIQ RLIALSEN                               398
//

If you have problems or comments...

PBIL Back to PBIL home page