(data stored in SCRATCH3701 zone)

EMBL: CP000435.LEPA

CP000435.LEPA        Location/Qualifiers
FT   CDS             617073..618887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="sync_0652"
FT                   /product="GTP-binding protein LepA"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM PF06421;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR01393"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45640"
FT                   /db_xref="GOA:Q0ICF2"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027518"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICF2"
FT                   /protein_id="ABI45640.1"
FT                   /translation="MTDAPVKRIRNFCIIAHIDHGKSTLADRLLQDTGTVANRDMQEQF
FT                   LDNMELERERGITIKLQAARMKYKAADGEEYVLNLIDTPGHVDFSYEVSRSLQACEGAL
FT                   LVVDASQGVEAQTLANVYMALENDLEIIPVLNKIDLPGADPDRIKEEIEAIIGLDCSNA
FT                   IPCSAKTGLGVPEILQSVVDRVPPPADTVKEPTKALIFDSYYDPYRGVIVYFRVMSGSI
FT                   SRKDKVLLMASNKTYELDEVGIMAPDEKKVDELHAGEVGYLAASIKAVADARVGDTITL
FT                   LNEPADAPLPGYAEAKPMVFCGLFPTEADQYPDLREALHKLQLSDAALKFEPETSSAMG
FT                   FGFRCGFLGLLHMEIVQERLEREYNLDLIVTAPSVIYNVNLTNGEQILVDNPATLPDPQ
FT                   QRESIEEPYVRMEIYAPNDFNGALMGLCQERRGEYLDMKYITKERVTLIYELPLAEVVT
FT                   DFFDQMKTRTQGYASMEYHLIGYRKNELVRLDVLINAERADPLTTIVHRDKAYNVGKGL
FT                   VEKLKELIPRQQFKIPLQASIGSRIIASTSISAIRKDVLAKCYGGDISRKKKLLKKQAK
FT                   GKKRMKAMGKVDVPQEAFMAVLKLNQTP"
     MTDAPVKRIR NFCIIAHIDH GKSTLADRLL QDTGTVANRD MQEQFLDNME LERERGITIK        60
     LQAARMKYKA ADGEEYVLNL IDTPGHVDFS YEVSRSLQAC EGALLVVDAS QGVEAQTLAN       120
     VYMALENDLE IIPVLNKIDL PGADPDRIKE EIEAIIGLDC SNAIPCSAKT GLGVPEILQS       180
     VVDRVPPPAD TVKEPTKALI FDSYYDPYRG VIVYFRVMSG SISRKDKVLL MASNKTYELD       240
     EVGIMAPDEK KVDELHAGEV GYLAASIKAV ADARVGDTIT LLNEPADAPL PGYAEAKPMV       300
     FCGLFPTEAD QYPDLREALH KLQLSDAALK FEPETSSAMG FGFRCGFLGL LHMEIVQERL       360
     EREYNLDLIV TAPSVIYNVN LTNGEQILVD NPATLPDPQQ RESIEEPYVR MEIYAPNDFN       420
     GALMGLCQER RGEYLDMKYI TKERVTLIYE LPLAEVVTDF FDQMKTRTQG YASMEYHLIG       480
     YRKNELVRLD VLINAERADP LTTIVHRDKA YNVGKGLVEK LKELIPRQQF KIPLQASIGS       540
     RIIASTSISA IRKDVLAKCY GGDISRKKKL LKKQAKGKKR MKAMGKVDVP QEAFMAVLKL       600
     NQTP                                                                    604
//

If you have problems or comments...

PBIL Back to PBIL home page