(data stored in SCRATCH3701 zone)

EMBL: CP000435.LIPA-1

CP000435.LIPA-1      Location/Qualifiers
FT   CDS             complement(397849..398727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA-1"
FT                   /locus_tag="sync_0389"
FT                   /product="lipoic acid synthetase"
FT                   /EC_number="2.8.1.-"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM TIGR00510"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47455"
FT                   /db_xref="GOA:Q0ID51"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID51"
FT                   /protein_id="ABI47455.1"
FT                   /translation="MTSIQKPDWLRVKAPQRERIGEVADLLLDLKLNTVCQEASCPNIG
FT                   ECFAGGTATFLIMGPGCTRACPYCDIDFDKSVRALDPTEPQRLGEAVSRLGLKHVVITS
FT                   VNRDDLEDGGASQFVACIEQVKQHSPLTTIELLIPDFCGNWDALATVMEASPHVLNHNI
FT                   ETVPRLYRQARPQGVYERSLELLKRVRDGWSRAYSKSGLMVGLGESDSEVIEVLRDLRE
FT                   HRVDIVTIGQYLSPGPKHLRVDRFVTPEQFESYRLKGEQELGFLQVVSTPLTRSSYHAG
FT                   EVQKLMTIHPR"
     MTSIQKPDWL RVKAPQRERI GEVADLLLDL KLNTVCQEAS CPNIGECFAG GTATFLIMGP        60
     GCTRACPYCD IDFDKSVRAL DPTEPQRLGE AVSRLGLKHV VITSVNRDDL EDGGASQFVA       120
     CIEQVKQHSP LTTIELLIPD FCGNWDALAT VMEASPHVLN HNIETVPRLY RQARPQGVYE       180
     RSLELLKRVR DGWSRAYSKS GLMVGLGESD SEVIEVLRDL REHRVDIVTI GQYLSPGPKH       240
     LRVDRFVTPE QFESYRLKGE QELGFLQVVS TPLTRSSYHA GEVQKLMTIH PR               292
//

If you have problems or comments...

PBIL Back to PBIL home page