(data stored in SCRATCH3701 zone)

EMBL: CP000435.MCRA

CP000435.MCRA        Location/Qualifiers
FT   CDS             complement(40998..41429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcrA"
FT                   /locus_tag="sync_0037"
FT                   /product="HNH endonuclease:HNH nuclease"
FT                   /note="identified by match to protein family HMM PF01844"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47543"
FT                   /db_xref="GOA:Q0IE46"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE46"
FT                   /protein_id="ABI47543.1"
FT                   /translation="MHSRDAVFLEDLCPKLRNRRWRQSIHLHTCNRCIYCGKPSESIDH
FT                   VFPLSRGGMSVTENCVPACLSCNGQKSDADVFDWYRRQRFYDPRRAMAIRAWTDGDLRL
FT                   AIRLLQWAQPEHNQPPNSKRANDTLTKGDDEQSWGLRTA"
     MHSRDAVFLE DLCPKLRNRR WRQSIHLHTC NRCIYCGKPS ESIDHVFPLS RGGMSVTENC        60
     VPACLSCNGQ KSDADVFDWY RRQRFYDPRR AMAIRAWTDG DLRLAIRLLQ WAQPEHNQPP       120
     NSKRANDTLT KGDDEQSWGL RTA                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page