(data stored in SCRATCH3701 zone)

EMBL: CP000435.METK

CP000435.METK        Location/Qualifiers
FT   CDS             complement(510969..512228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="sync_0529"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="identified by match to protein family HMM PF00438;
FT                   match to protein family HMM PF02772; match to protein
FT                   family HMM PF02773; match to protein family HMM TIGR01034"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47314"
FT                   /db_xref="GOA:Q0ICR7"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ICR7"
FT                   /protein_id="ABI47314.1"
FT                   /translation="MSRYVFTSESVTEGHPDKICDQVSDAVLDALLAQDSTSRVACETV
FT                   VNTGLCMITGEVTSKAQVDFIHLVRDVIRDIGYSGARAGGFDATSCAVLVALDQQSPDI
FT                   AQGVDEADDHAGDPLDKVGAGDQGIMFGYACNETPELMPLPISLAHRLARRLAEVRHNG
FT                   TLDYLLPDGKTQVSVVYENDKPVEIDTILISTQHTAEVTGLTDEQEVRNRISEDLWTHV
FT                   VLPATADLPLKPDRANCRYLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAF
FT                   SGKDPTKVDRSAAYAARYVAKALVAAGLANRAEVQLSYAIGVAKPVSILVESFGSGKVS
FT                   NAELTDLVQEHFDLRPGAIIEQFKLREMPSLNGGRFYRDTAAYGHFGRPDLNLPWEDVG
FT                   DKAASLKQAEANRIQSGSSL"
     MSRYVFTSES VTEGHPDKIC DQVSDAVLDA LLAQDSTSRV ACETVVNTGL CMITGEVTSK        60
     AQVDFIHLVR DVIRDIGYSG ARAGGFDATS CAVLVALDQQ SPDIAQGVDE ADDHAGDPLD       120
     KVGAGDQGIM FGYACNETPE LMPLPISLAH RLARRLAEVR HNGTLDYLLP DGKTQVSVVY       180
     ENDKPVEIDT ILISTQHTAE VTGLTDEQEV RNRISEDLWT HVVLPATADL PLKPDRANCR       240
     YLVNPTGKFV VGGPQGDAGL TGRKIIVDTY GGYARHGGGA FSGKDPTKVD RSAAYAARYV       300
     AKALVAAGLA NRAEVQLSYA IGVAKPVSIL VESFGSGKVS NAELTDLVQE HFDLRPGAII       360
     EQFKLREMPS LNGGRFYRDT AAYGHFGRPD LNLPWEDVGD KAASLKQAEA NRIQSGSSL        419
//

If you have problems or comments...

PBIL Back to PBIL home page