(data stored in SCRATCH3701 zone)

EMBL: CP000435.MGTE

CP000435.MGTE        Location/Qualifiers
FT   CDS             101040..102494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtE"
FT                   /locus_tag="sync_0097"
FT                   /product="magnesium transporter"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF01769; match to protein
FT                   family HMM PF03448; match to protein family HMM TIGR00400"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46452"
FT                   /db_xref="GOA:Q0IDY8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDY8"
FT                   /protein_id="ABI46452.1"
FT                   /translation="MEEAHGRSGVSVTNDLVAEVVTQQLESMLSVGNYDGVKLLLAPVQ
FT                   PVDVAEAVGCLPRTLQALAFRLLGKDEAIEVYEYLEPAIQQSLLERLRSSEVLELVEEM
FT                   SPDDRVRLLDELPAKVVRRLLVELSPAERRVTAQLLGYAPETAGRLMTTEYIDLKEFHS
FT                   AAQALTIVRRRATETETIYSLYVTDGQRHLTGILSLRDLVTADPTDCIGDVMTREVVSV
FT                   GTDTDQEEVARAIQRYDFLAVPVVDRERRLVGIVTVDDVIDVIEQEATRDLYAAGAVEA
FT                   GDEDDYFQSNLFTVARRRVLWLAVLVIANIFTTQVIAMNDAVLREVVMLAAFIPLLIGT
FT                   GGNVGAQSSTVVIRGLSTQRIQPLGPLRAVVREALAGALLGLLMLFVVVPFAWWRGDGP
FT                   LVGMAVGISLLAITTLAATAGAALPLLFSRMGLDPALMSAPFITTATDVAGVFIYLKTA
FT                   EWLLLHAPQLLEATSISTHLLAALAF"
     MEEAHGRSGV SVTNDLVAEV VTQQLESMLS VGNYDGVKLL LAPVQPVDVA EAVGCLPRTL        60
     QALAFRLLGK DEAIEVYEYL EPAIQQSLLE RLRSSEVLEL VEEMSPDDRV RLLDELPAKV       120
     VRRLLVELSP AERRVTAQLL GYAPETAGRL MTTEYIDLKE FHSAAQALTI VRRRATETET       180
     IYSLYVTDGQ RHLTGILSLR DLVTADPTDC IGDVMTREVV SVGTDTDQEE VARAIQRYDF       240
     LAVPVVDRER RLVGIVTVDD VIDVIEQEAT RDLYAAGAVE AGDEDDYFQS NLFTVARRRV       300
     LWLAVLVIAN IFTTQVIAMN DAVLREVVML AAFIPLLIGT GGNVGAQSST VVIRGLSTQR       360
     IQPLGPLRAV VREALAGALL GLLMLFVVVP FAWWRGDGPL VGMAVGISLL AITTLAATAG       420
     AALPLLFSRM GLDPALMSAP FITTATDVAG VFIYLKTAEW LLLHAPQLLE ATSISTHLLA       480
     ALAF                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page