(data stored in SCRATCH3701 zone)

EMBL: CP000435.MPEC

CP000435.MPEC        Location/Qualifiers
FT   CDS             complement(490716..491444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpeC"
FT                   /locus_tag="sync_0502"
FT                   /product="Phycoerythrin class II gamma chain, linker
FT                   polypeptide"
FT                   /note="identified by match to protein family HMM PF00427"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47888"
FT                   /db_xref="GOA:Q0ICU3"
FT                   /db_xref="InterPro:IPR001297"
FT                   /db_xref="InterPro:IPR016470"
FT                   /db_xref="InterPro:IPR038255"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICU3"
FT                   /protein_id="ABI47888.1"
FT                   /translation="MGIGIGPRLLSECPFAVTFDQYSPASSAALERVIVAAYRQVLGNL
FT                   PPTDNQRETSLEVRLMNGEITVRDFVNGLAKSDFYKDNFFHAVGAQRGIELNFKHLLGR
FT                   APLNQQEVQNHIKLQAEEGFDALIDTLTDSAEYTEVFGADIVPYDRTKDSYAGMYTRSF
FT                   NMMRDLGGMKVAISDNAQGRQSKTVNGLASALRESTKPQPFSYVSVSKIAVKLPQQQYT
FT                   GHNPPAMSDYVPFRPFGIFF"
     MGIGIGPRLL SECPFAVTFD QYSPASSAAL ERVIVAAYRQ VLGNLPPTDN QRETSLEVRL        60
     MNGEITVRDF VNGLAKSDFY KDNFFHAVGA QRGIELNFKH LLGRAPLNQQ EVQNHIKLQA       120
     EEGFDALIDT LTDSAEYTEV FGADIVPYDR TKDSYAGMYT RSFNMMRDLG GMKVAISDNA       180
     QGRQSKTVNG LASALRESTK PQPFSYVSVS KIAVKLPQQQ YTGHNPPAMS DYVPFRPFGI       240
     FF                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page