(data stored in SCRATCH3701 zone)

EMBL: CP000435.MPR

CP000435.MPR         Location/Qualifiers
FT   CDS             complement(464178..465254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpr"
FT                   /locus_tag="sync_0466"
FT                   /product="MRP protein homolog"
FT                   /note="identified by match to protein family HMM PF01883"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47144"
FT                   /db_xref="GOA:Q0ICX8"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICX8"
FT                   /protein_id="ABI47144.1"
FT                   /translation="MATAEQAAELLKGIVDAGSNRSVMDLGWLDRVRVDPPRAVLRLNL
FT                   PGFAQGQRERIVSEARERLLGLEAIQDVQIEVGTPPSQGGIGQAGHGQAAERQPIPGVK
FT                   QVIAVSSGKGGVGKSTVAVNLACSLAKQGLRVGLLDADIYGPNAPIMLGVADQSPEVSG
FT                   SGDDQRMIPLESCGVAMVSMGLLIEENQPVIWRGPMLNGIIRQFLYQVDWTERDVLIVD
FT                   LPPGTGDAQLSLAQAVPMAGVVIVTTPQKVALQDARRGLAMFLQMGVPVLGVVENMSAF
FT                   IPPDQPDKSYALFGSGGGQTLAEAFDVPLLAQIPMEMSVQEGGDQGQPISISHPNSASA
FT                   QAFKELAETLGNSLQAIG"
     MATAEQAAEL LKGIVDAGSN RSVMDLGWLD RVRVDPPRAV LRLNLPGFAQ GQRERIVSEA        60
     RERLLGLEAI QDVQIEVGTP PSQGGIGQAG HGQAAERQPI PGVKQVIAVS SGKGGVGKST       120
     VAVNLACSLA KQGLRVGLLD ADIYGPNAPI MLGVADQSPE VSGSGDDQRM IPLESCGVAM       180
     VSMGLLIEEN QPVIWRGPML NGIIRQFLYQ VDWTERDVLI VDLPPGTGDA QLSLAQAVPM       240
     AGVVIVTTPQ KVALQDARRG LAMFLQMGVP VLGVVENMSA FIPPDQPDKS YALFGSGGGQ       300
     TLAEAFDVPL LAQIPMEMSV QEGGDQGQPI SISHPNSASA QAFKELAETL GNSLQAIG         358
//

If you have problems or comments...

PBIL Back to PBIL home page