(data stored in SCRATCH3701 zone)

EMBL: CP000435.MQO

CP000435.MQO         Location/Qualifiers
FT   CDS             613665..615134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mqo"
FT                   /locus_tag="sync_0648"
FT                   /product="malate:quinone-oxidoreductase"
FT                   /EC_number="1.1.5.4"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF06039; match to protein
FT                   family HMM TIGR01320"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46045"
FT                   /db_xref="GOA:Q0ICF6"
FT                   /db_xref="InterPro:IPR006231"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICF6"
FT                   /protein_id="ABI46045.1"
FT                   /translation="MDRYDVVLVGAGIMSATLATLLHELDPELQLLVVERLEAPALESS
FT                   AAGNNAGTGHAANCELNYTPLQADGTISTEKPLAINASFESSLEFWATLSERGRLDPSC
FT                   FIHRVPHISFVWGEGDVAYLRQRYEQLKSLPAFAAMDWSRDEAELASWIPLVMAGRDPQ
FT                   IAVAATRIERGTDVDFGALSRSLFVPLQASGALDLVFGTSVSDLNRQAEGWELQLRGPS
FT                   GRRVVMTPFVFLGAGGGALPLLQRSGIPEATAYAGFPVSGQWLVCNDPDLSEHHFAKVY
FT                   GKAKVGAPPMSVPHLDSRWIDGRRSLLFGPYAGFSSKFLKQGSLLDLPRSVRSSNLLPM
FT                   LQVGVNNIPLVRYLVNQLRQSSEERMEALKAFLPTARTEDWTLSVAGQRVQIIKRTSAG
FT                   GRLQLGTEVVSAADGSLAALLGASPGASTSVEIMLEILQRCFPDRLASETWQQRLQALL
FT                   PSYGQDLNANGELLQRSRDRSDALLGLQIAR"
     MDRYDVVLVG AGIMSATLAT LLHELDPELQ LLVVERLEAP ALESSAAGNN AGTGHAANCE        60
     LNYTPLQADG TISTEKPLAI NASFESSLEF WATLSERGRL DPSCFIHRVP HISFVWGEGD       120
     VAYLRQRYEQ LKSLPAFAAM DWSRDEAELA SWIPLVMAGR DPQIAVAATR IERGTDVDFG       180
     ALSRSLFVPL QASGALDLVF GTSVSDLNRQ AEGWELQLRG PSGRRVVMTP FVFLGAGGGA       240
     LPLLQRSGIP EATAYAGFPV SGQWLVCNDP DLSEHHFAKV YGKAKVGAPP MSVPHLDSRW       300
     IDGRRSLLFG PYAGFSSKFL KQGSLLDLPR SVRSSNLLPM LQVGVNNIPL VRYLVNQLRQ       360
     SSEERMEALK AFLPTARTED WTLSVAGQRV QIIKRTSAGG RLQLGTEVVS AADGSLAALL       420
     GASPGASTSV EIMLEILQRC FPDRLASETW QQRLQALLPS YGQDLNANGE LLQRSRDRSD       480
     ALLGLQIAR                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page