(data stored in SCRATCH3701 zone)

EMBL: CP000435.MSCL

CP000435.MSCL        Location/Qualifiers
FT   CDS             complement(208476..208859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="sync_0202"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01741;
FT                   match to protein family HMM TIGR00220"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47563"
FT                   /db_xref="GOA:Q0IDN4"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDN4"
FT                   /protein_id="ABI47563.1"
FT                   /translation="MTRKPGLFADFKAFINKGNVVDLAIAVVIAGAFGKVVATVVTLVM
FT                   TNALEPALKAANVDSINSWPAGTVIVAIINFLVIAFVCFLIVKSIEASKRKQEVIAETK
FT                   PDPQAQLASAMTRLTDALERKGF"
     MTRKPGLFAD FKAFINKGNV VDLAIAVVIA GAFGKVVATV VTLVMTNALE PALKAANVDS        60
     INSWPAGTVI VAIINFLVIA FVCFLIVKSI EASKRKQEVI AETKPDPQAQ LASAMTRLTD       120
     ALERKGF                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page