(data stored in SCRATCH3701 zone)

EMBL: CP000435.MSRB-1

CP000435.MSRB-1      Location/Qualifiers
FT   CDS             18944..19456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrB-1"
FT                   /locus_tag="sync_0016"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.-"
FT                   /note="identified by match to protein family HMM PF01641;
FT                   match to protein family HMM TIGR00357"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47023"
FT                   /db_xref="GOA:Q0IE67"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE67"
FT                   /protein_id="ABI47023.1"
FT                   /translation="MTTSMQPWLLSRRSMLLASIAGMVGVLRAPDQVLAASKAGEATWD
FT                   LSDGEWKKRLSPEAYQVLRQEGTERPFTSPFNNEKREGTYLCAGCDLPLFASTAKFDSG
FT                   TGWPSFWQPLPGGVETKVDFKLILPRTEYHCRRCGGHQGHVFNDGPRPTGKRYCNNGVA
FT                   LRFQPTA"
     MTTSMQPWLL SRRSMLLASI AGMVGVLRAP DQVLAASKAG EATWDLSDGE WKKRLSPEAY        60
     QVLRQEGTER PFTSPFNNEK REGTYLCAGC DLPLFASTAK FDSGTGWPSF WQPLPGGVET       120
     KVDFKLILPR TEYHCRRCGG HQGHVFNDGP RPTGKRYCNN GVALRFQPTA                  170
//

If you have problems or comments...

PBIL Back to PBIL home page