(data stored in SCRATCH3701 zone)

EMBL: CP000435.MURB

CP000435.MURB        Location/Qualifiers
FT   CDS             complement(31841..32779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="sync_0027"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM PF02873; match to protein
FT                   family HMM TIGR00179"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47331"
FT                   /db_xref="GOA:Q0IE56"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IE56"
FT                   /protein_id="ABI47331.1"
FT                   /translation="MFTGDRGLNALLESGVLQQEVPLANYTTWRVGGPAQWLAEPNNAE
FT                   QCLELLQWAKAEGLTTRVIGAGSNLLIADAGLPGLTLCLRRLQGSQLDAESGQVKALAG
FT                   EPLPTLARRAARLGLHGLEWAVGIPGTVGGAAAMNAGAQGGSTADCLTAVEVIDQSLTD
FT                   TVKTTTLLSNTDLAYDYRHSLLQGSDQMVVAAQFQLEPGHDAKELMRKTSGNLSHRTTT
FT                   QPYQWPSCGSVFRNPEPEKAGQLIEGLGLKGRRIGGAEVSSVHANFIVNVGDATADDIR
FT                   ALIDLVQNEVERMNGITLHPEVKRLGFQTTD"
     MFTGDRGLNA LLESGVLQQE VPLANYTTWR VGGPAQWLAE PNNAEQCLEL LQWAKAEGLT        60
     TRVIGAGSNL LIADAGLPGL TLCLRRLQGS QLDAESGQVK ALAGEPLPTL ARRAARLGLH       120
     GLEWAVGIPG TVGGAAAMNA GAQGGSTADC LTAVEVIDQS LTDTVKTTTL LSNTDLAYDY       180
     RHSLLQGSDQ MVVAAQFQLE PGHDAKELMR KTSGNLSHRT TTQPYQWPSC GSVFRNPEPE       240
     KAGQLIEGLG LKGRRIGGAE VSSVHANFIV NVGDATADDI RALIDLVQNE VERMNGITLH       300
     PEVKRLGFQT TD                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page