(data stored in SCRATCH3701 zone)

EMBL: CP000435.MURC

CP000435.MURC        Location/Qualifiers
FT   CDS             complement(32755..34206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="sync_0028"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="identified by match to protein family HMM PF02875;
FT                   match to protein family HMM TIGR01082"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46504"
FT                   /db_xref="GOA:Q0IE55"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IE55"
FT                   /protein_id="ABI46504.1"
FT                   /translation="MADSIQPEKHIHFIGMGGIGMSALALILAERGHSVSGSDRKLTPA
FT                   MQALETKALAIFESQVSKNFAHLQSRGIEEPLVVVSTAIPSTNPELIEAQRLDLTIWHR
FT                   SDLLAWLIEQQPSIAVAGSHGKTTTSTVLTTLLATVGEDPTAVIGGVVPCYGSNGHKGN
FT                   GRLLVAEADESDGSLVKFKASLGIITNLELDHTDHYRNLDDLIETMKTFGRGCKRLLIN
FT                   HDDPILKEHFQADACWSVHHVETADYAALPVQLDGDRTIADYFEQGQKVGQITLPLPGL
FT                   HNLSNVVAALAACRMEGVPLEALLLAVTELRSPGRRFDFRGEWQDRQVVDDYAHHPSEV
FT                   QATLTMAQLMVQSGRSPLPRTPQRLLAVFQPHRYSRTQEFLNAFAQALVSADALVLAPI
FT                   YGAGEQPIEGINSELLARSIRLIDPNQPVFVASTMEELAGLVKQHSQPDDLILAMGAGD
FT                   VNSLWERLSQEGIGGEASCSPAIAA"
     MADSIQPEKH IHFIGMGGIG MSALALILAE RGHSVSGSDR KLTPAMQALE TKALAIFESQ        60
     VSKNFAHLQS RGIEEPLVVV STAIPSTNPE LIEAQRLDLT IWHRSDLLAW LIEQQPSIAV       120
     AGSHGKTTTS TVLTTLLATV GEDPTAVIGG VVPCYGSNGH KGNGRLLVAE ADESDGSLVK       180
     FKASLGIITN LELDHTDHYR NLDDLIETMK TFGRGCKRLL INHDDPILKE HFQADACWSV       240
     HHVETADYAA LPVQLDGDRT IADYFEQGQK VGQITLPLPG LHNLSNVVAA LAACRMEGVP       300
     LEALLLAVTE LRSPGRRFDF RGEWQDRQVV DDYAHHPSEV QATLTMAQLM VQSGRSPLPR       360
     TPQRLLAVFQ PHRYSRTQEF LNAFAQALVS ADALVLAPIY GAGEQPIEGI NSELLARSIR       420
     LIDPNQPVFV ASTMEELAGL VKQHSQPDDL ILAMGAGDVN SLWERLSQEG IGGEASCSPA       480
     IAA                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page