(data stored in SCRATCH3701 zone)

EMBL: CP000435.MUTM

CP000435.MUTM        Location/Qualifiers
FT   CDS             complement(537077..537949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="sync_0561"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="identified by match to protein family HMM PF01149;
FT                   match to protein family HMM PF06827; match to protein
FT                   family HMM PF06831; match to protein family HMM TIGR00577"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46475"
FT                   /db_xref="GOA:Q0ICP1"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICP1"
FT                   /protein_id="ABI46475.1"
FT                   /translation="MPELPEVETVRRGLANRLDQFVISDLEVCRDRAIASPGGPECFES
FT                   GLLNCRVGNWMRRGKYLYSELYRPGSAEANSAEESAGYWGVHLRMTGQFQWIEDDTPPC
FT                   KHTRVRFWNAKGQELRFVDLRSFAEMWWVPPDTAVESIITGLKKLGPEPFSQDFKTQYL
FT                   QERFKGSTRSIKAALLDQSIVAGTGNIYADESLFAAGICPQTPAGQLNRKQLEKLRECL
FT                   IEILELSIGAGGTTFSDFRDLEGVNGNYGGQAAVYRRTGQPCPKCGKAIERIKLAGRST
FT                   HWCSSCQTS"
     MPELPEVETV RRGLANRLDQ FVISDLEVCR DRAIASPGGP ECFESGLLNC RVGNWMRRGK        60
     YLYSELYRPG SAEANSAEES AGYWGVHLRM TGQFQWIEDD TPPCKHTRVR FWNAKGQELR       120
     FVDLRSFAEM WWVPPDTAVE SIITGLKKLG PEPFSQDFKT QYLQERFKGS TRSIKAALLD       180
     QSIVAGTGNI YADESLFAAG ICPQTPAGQL NRKQLEKLRE CLIEILELSI GAGGTTFSDF       240
     RDLEGVNGNY GGQAAVYRRT GQPCPKCGKA IERIKLAGRS THWCSSCQTS                  290
//

If you have problems or comments...

PBIL Back to PBIL home page