(data stored in SCRATCH3701 zone)

EMBL: CP000435.MVIN-1

CP000435.MVIN-1      Location/Qualifiers
FT   CDS             complement(180405..181898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mviN-1"
FT                   /locus_tag="sync_0171"
FT                   /product="integral membrane protein MviN"
FT                   /note="identified by match to protein family HMM PF03023"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46215"
FT                   /db_xref="GOA:Q0IDR4"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDR4"
FT                   /protein_id="ABI46215.1"
FT                   /translation="MSVLSSFYLVSILLLLGRVSGFFRDWLIAYVAGAGINSDLAVVLI
FT                   TLPDLVVNLVVGGGISASLVPKYQSIGESQSSALYLSLLKSFFIGFSIIACIISVLSPS
FT                   LISFLAPSAFRMGVDNVYLYLFALSTLAIPLTALSGLNQSLLVSKRQFLFSQPGNLIFN
FT                   LSIIACVFIGLRAQFLPSVVTGILLGSLIRLGWQYIGIIRQWTLPSKNKVRKGVSIGKS
FT                   LFATTVFAGIFSFLPVIGRSYSSSLYPGALSLFNYAFRLTEIPIALVFASLSTVYLPRL
FT                   SREYNEDITSCRKSIEDLVRFSLLISLFLCLPILLLSDQILSTVFAGGALETYQVQIVS
FT                   SLIIVFIFTIPFRGLTVLSLPLLSTTKKHGLLLAVSILTAAFSIPLMNISTRMYGLVGT
FT                   CASLGFAYIMPSVILFFSIARSLKFSLFQRVFRKPIQTFLVPSIASMLSCKLCISMFSH
FT                   QLLWIPSYILSIAVFIACLALEPSLRQDYSKLVLGLFRK"
     MSVLSSFYLV SILLLLGRVS GFFRDWLIAY VAGAGINSDL AVVLITLPDL VVNLVVGGGI        60
     SASLVPKYQS IGESQSSALY LSLLKSFFIG FSIIACIISV LSPSLISFLA PSAFRMGVDN       120
     VYLYLFALST LAIPLTALSG LNQSLLVSKR QFLFSQPGNL IFNLSIIACV FIGLRAQFLP       180
     SVVTGILLGS LIRLGWQYIG IIRQWTLPSK NKVRKGVSIG KSLFATTVFA GIFSFLPVIG       240
     RSYSSSLYPG ALSLFNYAFR LTEIPIALVF ASLSTVYLPR LSREYNEDIT SCRKSIEDLV       300
     RFSLLISLFL CLPILLLSDQ ILSTVFAGGA LETYQVQIVS SLIIVFIFTI PFRGLTVLSL       360
     PLLSTTKKHG LLLAVSILTA AFSIPLMNIS TRMYGLVGTC ASLGFAYIMP SVILFFSIAR       420
     SLKFSLFQRV FRKPIQTFLV PSIASMLSCK LCISMFSHQL LWIPSYILSI AVFIACLALE       480
     PSLRQDYSKL VLGLFRK                                                      497
//

If you have problems or comments...

PBIL Back to PBIL home page