(data stored in SCRATCH3701 zone)

EMBL: CP000435.NEUA-1

CP000435.NEUA-1      Location/Qualifiers
FT   CDS             complement(179716..180408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="neuA-1"
FT                   /locus_tag="sync_0170"
FT                   /product="CMP-N-acetylneuraminic acid synthetase"
FT                   /EC_number="2.7.7.43"
FT                   /note="identified by match to protein family HMM PF02348"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45735"
FT                   /db_xref="GOA:Q0IDR5"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDR5"
FT                   /protein_id="ABI45735.1"
FT                   /translation="MIDLAIIPARAGSKGLPGKNSADLGGYPLIAWTIRSAISANLFKR
FT                   VVVTTDSQHLADLSCKYGAEVPFLRPNDLATSEASSASVIYHCLDQTGCSGTFAFLQPT
FT                   SPFRNKDHIISAYKQFKSISPASSLISTVAGKPYQWCLESSPDQIVRPVTNSYALVSQR
FT                   QSTKPSIWPNGAIYLSDANLFRASGSFLSSHTQGFEMSEIDSIDIDYMDQLNVARAIVS
FT                   YGLRSIDK"
     MIDLAIIPAR AGSKGLPGKN SADLGGYPLI AWTIRSAISA NLFKRVVVTT DSQHLADLSC        60
     KYGAEVPFLR PNDLATSEAS SASVIYHCLD QTGCSGTFAF LQPTSPFRNK DHIISAYKQF       120
     KSISPASSLI STVAGKPYQW CLESSPDQIV RPVTNSYALV SQRQSTKPSI WPNGAIYLSD       180
     ANLFRASGSF LSSHTQGFEM SEIDSIDIDY MDQLNVARAI VSYGLRSIDK                  230
//

If you have problems or comments...

PBIL Back to PBIL home page