(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE101

CP000435.PE101       Location/Qualifiers
FT   CDS             110274..111266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0103"
FT                   /product="Sugar kinase, ribokinase family protein"
FT                   /EC_number="2.7.1.4"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47458"
FT                   /db_xref="GOA:Q0IDY2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDY2"
FT                   /protein_id="ABI47458.1"
FT                   /translation="MADLSALAPRVMCLGEALVDRLGPLGGDPVTAAPESCDDRLGGAP
FT                   ANVACALARLGTPVGLVGRLGEDSIGSAFRDLFQQRGVAVQALQRDVSHPSRVVLVRRH
FT                   ANGERVFQGFAGDHALGFADQMLNLGELEAVWPMVSKQARWLLVGTIPLATPTSADSLQ
FT                   WLLAQAQAASLALAVDVNWRPTFWDPEADPAAGPTADALAVIKPLLEQASLIKLAREEA
FT                   LWFFGSDDPAAVAKDLPQQPDVVVTDGANPIRWFIEHEAGSMPVFQPSQVIDTTGAGDA
FT                   FTAGLLHCWDRPVNERLYFASACGALVCSGAGAIDPQPQEQDVLTFLNR"
     MADLSALAPR VMCLGEALVD RLGPLGGDPV TAAPESCDDR LGGAPANVAC ALARLGTPVG        60
     LVGRLGEDSI GSAFRDLFQQ RGVAVQALQR DVSHPSRVVL VRRHANGERV FQGFAGDHAL       120
     GFADQMLNLG ELEAVWPMVS KQARWLLVGT IPLATPTSAD SLQWLLAQAQ AASLALAVDV       180
     NWRPTFWDPE ADPAAGPTAD ALAVIKPLLE QASLIKLARE EALWFFGSDD PAAVAKDLPQ       240
     QPDVVVTDGA NPIRWFIEHE AGSMPVFQPS QVIDTTGAGD AFTAGLLHCW DRPVNERLYF       300
     ASACGALVCS GAGAIDPQPQ EQDVLTFLNR                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page