(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE103

CP000435.PE103       Location/Qualifiers
FT   CDS             complement(112332..113687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0105"
FT                   /product="putative glutamine synthetase"
FT                   /note="identified by match to protein family HMM PF00120"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45205"
FT                   /db_xref="GOA:Q0IDY0"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDY0"
FT                   /protein_id="ABI45205.1"
FT                   /translation="MSTEHDTSLEALSARGVRQIAITWDNHAGESLVKVVPLRRWQLAI
FT                   DVGVGFSPISDAFRSDGIIDPAHRLTRPDGDLRLKADPSSLAMLEPDQGWAWAAGERWN
FT                   RNSTGAYEADQRHFCRRMGETLHRKGLSLTAGFELEWVVITPDNDGSPKAVIAGGPYGA
FT                   DRLIEGLDYASALLKALDAADVDWLQFHPEYGPSQFELSFAAQAPLQAADQLIRARLVI
FT                   QRVTRRFGWFSSFSAKPRLDWVGNGGHLHFSVRDSQGPLLQEGSGPYGLRPEGEALIAG
FT                   VLEQLPGLVALASPSPVSYLRLVPSSWSAPFQVWGMENREAAVRFIPTASDQSAAHLEI
FT                   KAVDPTANPYLLLGALQAQVLDAMRHKRILPPEQIGDPALVNDHSVCRLPASLVEARIA
FT                   LERDAVLLEAMGPLLHGSLLDSLAAEIHRVETKSEEQQVSDSCWWPIVGGLV"
     MSTEHDTSLE ALSARGVRQI AITWDNHAGE SLVKVVPLRR WQLAIDVGVG FSPISDAFRS        60
     DGIIDPAHRL TRPDGDLRLK ADPSSLAMLE PDQGWAWAAG ERWNRNSTGA YEADQRHFCR       120
     RMGETLHRKG LSLTAGFELE WVVITPDNDG SPKAVIAGGP YGADRLIEGL DYASALLKAL       180
     DAADVDWLQF HPEYGPSQFE LSFAAQAPLQ AADQLIRARL VIQRVTRRFG WFSSFSAKPR       240
     LDWVGNGGHL HFSVRDSQGP LLQEGSGPYG LRPEGEALIA GVLEQLPGLV ALASPSPVSY       300
     LRLVPSSWSA PFQVWGMENR EAAVRFIPTA SDQSAAHLEI KAVDPTANPY LLLGALQAQV       360
     LDAMRHKRIL PPEQIGDPAL VNDHSVCRLP ASLVEARIAL ERDAVLLEAM GPLLHGSLLD       420
     SLAAEIHRVE TKSEEQQVSD SCWWPIVGGL V                                      451
//

If you have problems or comments...

PBIL Back to PBIL home page