(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE111

CP000435.PE111       Location/Qualifiers
FT   CDS             120916..121419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0113"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47648"
FT                   /db_xref="GOA:Q0IDX2"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDX2"
FT                   /protein_id="ABI47648.1"
FT                   /translation="MARLHSQPICVASGLLVPLISLAAPSWLSLGGVLPSWAVLWLLPW
FT                   ALVDGPVSGLIAGAAMGLVLDGLSVGDASQVPALMLLGWWWGWLGRRGPPIQRSLNLGL
FT                   LAWIGTMLLGLTLWAQLLVQGVDAPLAQAFAFHTCLAQGLMTGLMAPMIGSWQLLIWRR
FT                   RTPA"
     MARLHSQPIC VASGLLVPLI SLAAPSWLSL GGVLPSWAVL WLLPWALVDG PVSGLIAGAA        60
     MGLVLDGLSV GDASQVPALM LLGWWWGWLG RRGPPIQRSL NLGLLAWIGT MLLGLTLWAQ       120
     LLVQGVDAPL AQAFAFHTCL AQGLMTGLMA PMIGSWQLLI WRRRTPA                     167
//

If you have problems or comments...

PBIL Back to PBIL home page