(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE112

CP000435.PE112       Location/Qualifiers
FT   CDS             121380..122723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0114"
FT                   /product="Bacterial extracellular solute-binding protein,
FT                   family 1"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45680"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDX1"
FT                   /protein_id="ABI45680.1"
FT                   /translation="MATSDLATAHSRMIQHTSHRRRWLALALLSTSLLIGGCRRAAAPE
FT                   GALQLWTLQLAPKFNTYMEQVIDRWDDGHPDAPVRWTDLPWGSVERKLLAAVFARTAPD
FT                   VVNLNPPFAANLASKGGLTDLTPLLPPDAAQRYLPSVWRAARDPKAGQIAVPWYLTVRL
FT                   SLVNQKLLQQAGVNAPPRRWEDVPAFARQIRERTGRYGLFVTAVPDDSAELLESMVQMG
FT                   VVLLDDKQRAGFNSPEGRKAFAFWTDLYREGLLPREVVSQGQRRAIELYQSGQLALLAS
FT                   GAEFLRSIQTNAPGVAAVTSPQPPLTGGDGTANVALMTLAVPRQSQRAQEALSFALDLT
FT                   NGPNQARFAREARVLPSSLEALRQVRAELEAERPATPELAQVREARLLSAKTLERARVL
FT                   VPATPGVKRLQSIVYTQLQRAMLGQISSEEAVRTAAEQWNRYSEARWP"
     MATSDLATAH SRMIQHTSHR RRWLALALLS TSLLIGGCRR AAAPEGALQL WTLQLAPKFN        60
     TYMEQVIDRW DDGHPDAPVR WTDLPWGSVE RKLLAAVFAR TAPDVVNLNP PFAANLASKG       120
     GLTDLTPLLP PDAAQRYLPS VWRAARDPKA GQIAVPWYLT VRLSLVNQKL LQQAGVNAPP       180
     RRWEDVPAFA RQIRERTGRY GLFVTAVPDD SAELLESMVQ MGVVLLDDKQ RAGFNSPEGR       240
     KAFAFWTDLY REGLLPREVV SQGQRRAIEL YQSGQLALLA SGAEFLRSIQ TNAPGVAAVT       300
     SPQPPLTGGD GTANVALMTL AVPRQSQRAQ EALSFALDLT NGPNQARFAR EARVLPSSLE       360
     ALRQVRAELE AERPATPELA QVREARLLSA KTLERARVLV PATPGVKRLQ SIVYTQLQRA       420
     MLGQISSEEA VRTAAEQWNR YSEARWP                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page