(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE113

CP000435.PE113       Location/Qualifiers
FT   CDS             122862..123629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0115"
FT                   /product="two-component response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46316"
FT                   /db_xref="GOA:Q0IDX0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDX0"
FT                   /protein_id="ABI46316.1"
FT                   /translation="MPTDGPSVKGTILVVDDEPAVRRVLLMRLQLAGYNVVSAEDGEEA
FT                   LEKFHSESPDLVVLDVMLPKMDGFAVCRRLRAESCVPIIFLSALESISERVAGLDLGAD
FT                   DYLPKPFSPKELEARIFTILRRVGSGSATVEPREIPSGQGVMRVGDLVVDTNRRQVNRG
FT                   TERIALTYTEFSLLELLFRDPGHVVPRAEILEQLWGYPPRRAADLRVVDVYVARLRGKL
FT                   EPDPRNPEMILTVRGIGYSSQRMGEPAGAPAAV"
     MPTDGPSVKG TILVVDDEPA VRRVLLMRLQ LAGYNVVSAE DGEEALEKFH SESPDLVVLD        60
     VMLPKMDGFA VCRRLRAESC VPIIFLSALE SISERVAGLD LGADDYLPKP FSPKELEARI       120
     FTILRRVGSG SATVEPREIP SGQGVMRVGD LVVDTNRRQV NRGTERIALT YTEFSLLELL       180
     FRDPGHVVPR AEILEQLWGY PPRRAADLRV VDVYVARLRG KLEPDPRNPE MILTVRGIGY       240
     SSQRMGEPAG APAAV                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page