(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE115

CP000435.PE115       Location/Qualifiers
FT   CDS             125216..125479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0117"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE20323.1"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46488"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDW8"
FT                   /protein_id="ABI46488.1"
FT                   /translation="MSGERVGFRFKHADAVVKRNPQGRSRRGWVMEPVEQTTSRGTKMP
FT                   AYRIRWRDSERPEIVLQHMLIADPDPTPPPENVSLEPPAPKA"
     MSGERVGFRF KHADAVVKRN PQGRSRRGWV MEPVEQTTSR GTKMPAYRIR WRDSERPEIV        60
     LQHMLIADPD PTPPPENVSL EPPAPKA                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page