(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE118

CP000435.PE118       Location/Qualifiers
FT   CDS             complement(126245..127156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45159"
FT                   /db_xref="GOA:Q0IDW5"
FT                   /db_xref="InterPro:IPR017804"
FT                   /db_xref="InterPro:IPR019257"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035094"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDW5"
FT                   /protein_id="ABI45159.1"
FT                   /translation="MGQLVRIGLNRCPRQLPAWFLYDEEGSRLFDRICQQPEYSLTRTE
FT                   IALLELRAPEIAAAIGDGVIIEFGAGSAQKVGPLLDAVRPAAYVALDISAEHLRKATTA
FT                   LQQRYPAVPMLGICCDHSTLSAVPEHPFLRDQRRIGFFPGSSLGNFEQHDAVHLLRHFK
FT                   QLLNGGPLLLGLDQPKSKIRLEAAYNDAAGISADFARNLLHRLNAELGANFDPQCFSYQ
FT                   ARWQADQQRVQMALISSCKQVVRIAGDSWTFQCDEPLITEYSLKYSPQKAVALAQQAGW
FT                   RWVRRWHDPDDDLSLHLLKAPD"
     MGQLVRIGLN RCPRQLPAWF LYDEEGSRLF DRICQQPEYS LTRTEIALLE LRAPEIAAAI        60
     GDGVIIEFGA GSAQKVGPLL DAVRPAAYVA LDISAEHLRK ATTALQQRYP AVPMLGICCD       120
     HSTLSAVPEH PFLRDQRRIG FFPGSSLGNF EQHDAVHLLR HFKQLLNGGP LLLGLDQPKS       180
     KIRLEAAYND AAGISADFAR NLLHRLNAEL GANFDPQCFS YQARWQADQQ RVQMALISSC       240
     KQVVRIAGDS WTFQCDEPLI TEYSLKYSPQ KAVALAQQAG WRWVRRWHDP DDDLSLHLLK       300
     APD                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page