(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE119

CP000435.PE119       Location/Qualifiers
FT   CDS             complement(127222..128493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0121"
FT                   /product="Domain of unknown function (DUF323) family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03781"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47836"
FT                   /db_xref="GOA:Q0IDW4"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017806"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDW4"
FT                   /protein_id="ABI47836.1"
FT                   /translation="MASLGSLSRATPAMESGTLLSRLMDVRRTSEVLIEPLEAEDLCLQ
FT                   GMADASPPKWHLAHTTWFFETFVLIPHCPGYEGADPSWNYLFNSYYDAVGPRQPRPQRG
FT                   LLSRPPIAEVIAWRHKVDQALENLLEHNGDFPWLGLVELGLQHEQQHQELMLMDLLDAF
FT                   SRQPLEPAYRTDWQEPAGSPNDGTAAVWLQFEGGLVEIGQNSQQNNNSNNAHPFHFDNE
FT                   EPRHRVWLEPYALADRLVSNGEYKAFIEDGGYERPELWMSEGWAICSERQWKAPRYWRQ
FT                   AQSNQQQRDQTAWEFTLAGRCPLEAHRPVRHLSWFEADAYARWAGSRLPTEAEWETAAQ
FT                   KQGLQLKQKHAELWQWTASPYRPYPGFQAAQGAVGEYNGKFMTSQFVLRGSSQLTPNGH
FT                   ARDTYRNFFAPSSRWMAAGLRLAR"
     MASLGSLSRA TPAMESGTLL SRLMDVRRTS EVLIEPLEAE DLCLQGMADA SPPKWHLAHT        60
     TWFFETFVLI PHCPGYEGAD PSWNYLFNSY YDAVGPRQPR PQRGLLSRPP IAEVIAWRHK       120
     VDQALENLLE HNGDFPWLGL VELGLQHEQQ HQELMLMDLL DAFSRQPLEP AYRTDWQEPA       180
     GSPNDGTAAV WLQFEGGLVE IGQNSQQNNN SNNAHPFHFD NEEPRHRVWL EPYALADRLV       240
     SNGEYKAFIE DGGYERPELW MSEGWAICSE RQWKAPRYWR QAQSNQQQRD QTAWEFTLAG       300
     RCPLEAHRPV RHLSWFEADA YARWAGSRLP TEAEWETAAQ KQGLQLKQKH AELWQWTASP       360
     YRPYPGFQAA QGAVGEYNGK FMTSQFVLRG SSQLTPNGHA RDTYRNFFAP SSRWMAAGLR       420
     LAR                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page