(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE123

CP000435.PE123       Location/Qualifiers
FT   CDS             132258..133067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0125"
FT                   /product="tetratricopeptide repeat protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46760"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDW0"
FT                   /protein_id="ABI46760.1"
FT                   /translation="MSFDPKRWLSLLLAAFGVVVLLGADPALAESLPTDQHRQLFEQAL
FT                   RFSRQGDPQKALEGWDQVLELAPDDAAAWSNRGNVRLVLGDTEGAIADQTKAIALAPEE
FT                   SDPHLNRGTAEEALQHWKEAEQDYNWILKRDPEDASALYNLGNVRGSEGDWQSAESLYG
FT                   RAAEARPGFAMARSSRALALYQLEAFDEAEREMRNLIRRYPMFADARAGLSALLWIRGS
FT                   RGEAESNWAAASGLDPSYREADWLLQVRRWPPRPVADLQRFLALESP"
     MSFDPKRWLS LLLAAFGVVV LLGADPALAE SLPTDQHRQL FEQALRFSRQ GDPQKALEGW        60
     DQVLELAPDD AAAWSNRGNV RLVLGDTEGA IADQTKAIAL APEESDPHLN RGTAEEALQH       120
     WKEAEQDYNW ILKRDPEDAS ALYNLGNVRG SEGDWQSAES LYGRAAEARP GFAMARSSRA       180
     LALYQLEAFD EAEREMRNLI RRYPMFADAR AGLSALLWIR GSRGEAESNW AAASGLDPSY       240
     READWLLQVR RWPPRPVADL QRFLALESP                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page