(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE125

CP000435.PE125       Location/Qualifiers
FT   CDS             134236..134466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0127"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47255"
FT                   /db_xref="GOA:Q0IDV8"
FT                   /db_xref="InterPro:IPR021524"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDV8"
FT                   /protein_id="ABI47255.1"
FT                   /translation="MSRQSRTRIHIVLSLAAPLMILLGVSAMLQREGPDRWQALPAILV
FT                   GSGLVIHAVVGRRHRRHQLLIALRTTRSQED"
     MSRQSRTRIH IVLSLAAPLM ILLGVSAMLQ REGPDRWQAL PAILVGSGLV IHAVVGRRHR        60
     RHQLLIALRT TRSQED                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page