(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE136

CP000435.PE136       Location/Qualifiers
FT   CDS             complement(144179..144307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0138"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46300"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDU7"
FT                   /protein_id="ABI46300.1"
FT                   /translation="MALQKMVMADQAPPTQWFPSAFALDGGSRALRDFVRLIYRAW"
     MALQKMVMAD QAPPTQWFPS AFALDGGSRA LRDFVRLIYR AW                           42
//

If you have problems or comments...

PBIL Back to PBIL home page