(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE138

CP000435.PE138       Location/Qualifiers
FT   CDS             complement(145603..146538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0140"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47558"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDU5"
FT                   /protein_id="ABI47558.1"
FT                   /translation="MPTFTALAPRLSLLKYYILRIFIGSFYRSVSKLAPNLLELNSFFL
FT                   RMQIQREPLDTCFFRLFLQVFDLTLIDFGANHGEFTTAALPSRDSTAKLIDANYELQKR
FT                   TKKRVEKLGFFNLDFISGCVGADHTKSLYLCFEKSHTGAAEVTSDFHLYKSRGCICEPV
FT                   NSLSPHDYIDKRIKYAAKIDIEGLELDLLKELWTAQYLSSILIVGVEATYSSQLRSIYN
FT                   HLAEFEFVLYASNHLWYTGSSLIDQFSCCYANIVNNRFDLKPRNLSDVALSCPFSMVYF
FT                   INKRLLECSLASKSRTTTRILHQDFWGVTN"
     MPTFTALAPR LSLLKYYILR IFIGSFYRSV SKLAPNLLEL NSFFLRMQIQ REPLDTCFFR        60
     LFLQVFDLTL IDFGANHGEF TTAALPSRDS TAKLIDANYE LQKRTKKRVE KLGFFNLDFI       120
     SGCVGADHTK SLYLCFEKSH TGAAEVTSDF HLYKSRGCIC EPVNSLSPHD YIDKRIKYAA       180
     KIDIEGLELD LLKELWTAQY LSSILIVGVE ATYSSQLRSI YNHLAEFEFV LYASNHLWYT       240
     GSSLIDQFSC CYANIVNNRF DLKPRNLSDV ALSCPFSMVY FINKRLLECS LASKSRTTTR       300
     ILHQDFWGVT N                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page