(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE146

CP000435.PE146       Location/Qualifiers
FT   CDS             complement(154198..154335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0148"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47673"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDT7"
FT                   /protein_id="ABI47673.1"
FT                   /translation="MNHSELPHFDAGECQSFGEVVELLLPPASGFNKIAVSAQRTPYSC
FT                   "
     MNHSELPHFD AGECQSFGEV VELLLPPASG FNKIAVSAQR TPYSC                        45
//

If you have problems or comments...

PBIL Back to PBIL home page