(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE151

CP000435.PE151       Location/Qualifiers
FT   CDS             160916..161539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0153"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PIR:AB1913"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46090"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDT2"
FT                   /protein_id="ABI46090.1"
FT                   /translation="MLFLLLTPQPVEPPPLRPALQRVQTSSRVQLLRRGEQATLSMQVP
FT                   VPIDRAWAVLTNYARTFAAMQDVAAVQLVSRQGQKLRLKQVLQAPYTFGLRINVLLEGE
FT                   ENPQSRSLRYRLVRGENIRALSGEWTLTQDAGGTLVRHTIRLQPEIPGLLQSSFRSLHD
FT                   ASLRQSFETLRQLMLGPALSDNRVPSNSATTTTTPSPLSVKAKG"
     MLFLLLTPQP VEPPPLRPAL QRVQTSSRVQ LLRRGEQATL SMQVPVPIDR AWAVLTNYAR        60
     TFAAMQDVAA VQLVSRQGQK LRLKQVLQAP YTFGLRINVL LEGEENPQSR SLRYRLVRGE       120
     NIRALSGEWT LTQDAGGTLV RHTIRLQPEI PGLLQSSFRS LHDASLRQSF ETLRQLMLGP       180
     ALSDNRVPSN SATTTTTPSP LSVKAKG                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page