(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE155

CP000435.PE155       Location/Qualifiers
FT   CDS             complement(170482..171609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0157"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45791"
FT                   /db_xref="GOA:Q0IDS8"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDS8"
FT                   /protein_id="ABI45791.1"
FT                   /translation="MRVLIFTSSGGTAHDAAAYAIEAWLKRWDPDGEVLVEHVLENASV
FT                   FTRAGVALYNWIQRHGPWMHQIYWRVVEFEDVTKPGTLLAGRFYVIRLLRRLQPDLLIS
FT                   THPHINRGHFDLARRVCPNLRCITCCTELDGGFGFSRNWLTRSADVFWTLTPEVSADVR
FT                   RRGYKRVPVPALGPLFDPAFEEELARPERGISADQLPLLVLGAGANGANNHIRLLDVLL
FT                   PLAGRLRVVALCGRRQAALDQLRQWAEQHPQLSLKPLGFQGPAEMAKLYKQAWAMVARP
FT                   GARTATEALAAGTVLIFNGFGMTMPQELLARRYFQARQIDCCIRKPQDLLDLCSRWLDH
FT                   PERYQTLKAQVGRHPLVADREAIRSLLLDGDFAKG"
     MRVLIFTSSG GTAHDAAAYA IEAWLKRWDP DGEVLVEHVL ENASVFTRAG VALYNWIQRH        60
     GPWMHQIYWR VVEFEDVTKP GTLLAGRFYV IRLLRRLQPD LLISTHPHIN RGHFDLARRV       120
     CPNLRCITCC TELDGGFGFS RNWLTRSADV FWTLTPEVSA DVRRRGYKRV PVPALGPLFD       180
     PAFEEELARP ERGISADQLP LLVLGAGANG ANNHIRLLDV LLPLAGRLRV VALCGRRQAA       240
     LDQLRQWAEQ HPQLSLKPLG FQGPAEMAKL YKQAWAMVAR PGARTATEAL AAGTVLIFNG       300
     FGMTMPQELL ARRYFQARQI DCCIRKPQDL LDLCSRWLDH PERYQTLKAQ VGRHPLVADR       360
     EAIRSLLLDG DFAKG                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page